Word ToolSet
Definitions Synonyms Rhymes Word Finder Blog
/
    /
      Definitions Synonyms Rhymes Word Finder Blog
      1. Rhymes
      2. Enzyme
      Meaning Synonyms Antonyms Rhymes Sentences Translate Word Type Pronunciation Word Forms Word Finder

      Enzyme

      //ˈɛn.zaɪm//

      Words that Rhyme with "enzyme" (101 found)

      Unknown101

      timeprimeclimbsublimelimerhymechimedimecrimeslimepantomimemimeparadigmlifetimeone-timesometimeanytimelymegrimeovertime
      Show 81 more
      maritimedaytimepastimeragtimedowntimemeantimenighttimebedtimewartimethymeonetimecentimepeacetimeblenheimdinnertimehalf-timeshowtimespace-timepart-timespringtimelongtimereal-timebig-timelunchtimei'mfull-timenoontimehalftimeairtimesummertimeschooltimewintertimemealtimechristmastimeanaheimrealtimeall-timesymeguggenheimwaldheimwindchimeeverytimefulltimeoppenheimparttimeprimetimeanticrimehaimseimsondheimflextimehimealltimekimesimenesheimdurkheimheimwarehimeopheimquicktimeamandimebeimclothestimefloersheimfloresheimflorsheimfuntimegenzymehochenheimingelheimkuenheimmovietimepulmazymepulmozymesolheimstraszheimsundheimwerdesheimwindheimwineheim

      More for "enzyme"

      MeaningPronunciationSynonyms

      Next best steps

      DefinitionSynonymsSentencesRead the blog

      Data sourced from Wiktionary, WordNet, CMU, and other open linguistic databases. Updated March 2026.

      Word of the Day verbose Synonym focus refined Latest posts Read the blog
      Word ToolSet

      Free online word tools: definitions, synonyms, antonyms, rhymes, translations, and more.

      Word Tools

      • Definitions
      • Synonyms
      • Antonyms
      • Rhymes
      • Sentences

      More Tools

      • Translate
      • Word Finder
      • Word Type
      • Pronunciation
      • Word Forms

      Information

      • Blog
      • Word Guides
      • Word Hubs
      • Topic Clusters
      • 5-Minute Packs
      • About
      • Contact
      • Privacy Policy
      • Terms of Service
      • Sitemap

      © 2026 WordToolSet.com

      Definitions/meaning Synonyms/synonyms Antonyms/antonyms Rhymes/rhymes Translate/translate Sentences/sentences Word Finder/word-finder Blog/blog Word Games/games Daily Anagram/games/daily-anagram Synonym Sprint/games/synonym-sprint Word Ladder Lite/games/word-ladder-lite Word Type/word-type Pronunciation/pronunciation Word Forms/word-forms