Create

/kɹiːˈeɪt/

Synonyms for "create" (450 found)

Ranked by relevance and common usage.

Closest matches (90)

Verb(19 words)
makeproducecausegenerateaffordsassembledbegatbirthedbring forthcarvescoinedcompose a paragraphcompose a postcardcomposedconjuresconsedconstitutesconstructconstruct a model
Noun(37 words)
affixesarraysartart and craftatmosphere ocean modelauthoringbe originalbe producedbenchmarking conceptbirthbirth of modern sciencebirthingbirthsbook coverbuilding systemcabinet level rolescarvingcauseschart templatechronicle the growth
Show 17 more words
cited sourceclass feature piececlass schedulingcodebook designcoinscollagescommunity centerscomposcompose a lettercompose a poemcomposingcomposition writingcompoundingcomputer generatedconcoctingconstitutingconstruct a graph
Adjective(4 words)
agricultural producebasic designbasic life formcomposed work
assembleauthorbearbegetbeginblock outbreak groundbreak the icebreedbringbring aboutbring forthbring into beingbring to effectbring to passbuildcall into beingcarvecastcause
Show 10 more words
chiselcoincomposecompoundconceitconceiveconceptualizeconcoctconstituteconstruct

Strong matches (135)

Noun(60 words)
construct based taskconstructed examplecontrive a storycraftcraft a modelcraft markercraft outcomecraft producedcraft projectcraft stylecraft taskcraft techniquecraftingcrateringcreative work outputdatabasedeepfakedesign a lessondesign a modeldesign attribute values
Show 40 more words
design curriculumdesign descriptordesign educationdesign modeldesign model frameworkdesign place value contentdesign release stagedesigned for learningdesignsdeveloped civilizationdevelopment programdistrict conduct proceduredoing worddutch artdutches artenergy forms worksheetengenderingessay promptestablish weekly patternestablishingevokingfilagreeflangeflawingfolk craftforgesforkform a pondform basedform manualsform proceduresformal language formformed fromformsforms of energyfoundingfounding of civilizationfrench formegallery workgenerate random values
Verb(40 words)
contrivecraft a lessoncraft a posterdeliver contentderegulatesderivedderivingdesigndevelopdevelopeddeveloping skilldeviseengenderengenderedestablish a committeeestablish a factestablish a linkestablish a policyestablish a programestablish a tradition
Show 20 more words
establish benchmarkestablish new disciplineestablishedestablishing a ruleevolvefacilitatefatheredforgedformform a choirform a routineform the basisformedformingforthbringfound a clubfound evidencefoundedfoundsgenerate random sequence
Adjective(1 words)
dutch componeren

Related words (225)

Noun(80 words)
generated electrical energygeneratinggovernment agency formsgrade level math worksheetsgroup noungroup projects presentationimaginingincorporatinginfographic designinstitutesinstitutinginvent a gameinvent locallyinventingitalian comporreitalian formalogo designmade thingmakingmaking art
Show 60 more words
memesmintingmintsmodel textmore revolutionarily designedmost engineered changenarrated digital storyneighborhood gardennestsorganized government agencyoriginal workoutputpattern a garmentpattern producingpiece of artplain designsportuguese comporportuguese formaposespouchesprimary grade bilingual planproduce bubblesproduce dataproduce deterministic valuesproduce energyproduce evidenceproduce random numbersproduce sectionproduced byproducingproducing resultsproduction yieldprogramproofing documentprovide an examplereport templatesresultriddlesscoresset of natural numbersshimmeringsocketsspanish formaspawningspawning areaspawnssproutsstructure argumentswedish produceratermerthe resultto producetraditionally designedwaves modulewetland ecosystem serviceswhelpswikiwritingyield factoryielded to pressure
Adjective(16 words)
german produzierenhandcraftedimprovised methodminimalist designnonacademic craftone-off motif designopen routeorganized bureaucracyorganized cluborganized societyoriginal mixpioneering methodproductive resultsprogrammatic termsswedish madetailored lesson plan
gestategetget upgive birth togive occasion togive origin togive rise tohatchheadhead uphewideateimagineinaugurateinditeinduceinitiateinnovateinstituteinvent
Show 68 more words
kneadknock outlay outleadlead offlead the waylick into shapemakemake upmanufacturemastermindmaturemintmodelmoldmouldmouldermouldyoccasionorganizeoriginateoutputparentpatch togetherpiece togetherpioneerprecedeprefabricateprepareprocreateproduceput togetherput upraiserealizerearrenderrevolutionizerough outroughcastroughhewrun upscriptsculptsculpturesetset afloatset on footset upshamshapesirespawnstampstand firststartsupposetailortake the initiativetake the leadtake the plungethermoformthinkthink upturnwhomp upworkwrite

Choosing the right synonym

  • Closest matches in this entry: make, produce, cause, generate, affixes.
  • design: 'Design' emphasizes planning and intention, the blueprint before the execution. You design before you build.
  • Sentence evidence is available for create, so synonym choice can be checked against real usage rather than a flat word list.
  • Ranking signals come from wiktionary, wordnet, opengloss, derived_reverse, and related lexical sources.

Synonym selection checklist

  • Match the part of speech before comparing meanings.
  • Check whether the synonym changes intensity, formality, or emotional tone.
  • Read the replacement inside the full sentence, not just beside "create".
  • Prefer the clearest word over the most unusual word when writing for speed or comprehension.

When not to replace "create"

Keep "create" when the sentence already sounds natural, when a synonym would add unintended emphasis, or when readers need the most familiar wording. A synonym should clarify or sharpen the message, not simply make the sentence look more varied.

If two options seem close, choose the one that best matches the audience and purpose of the sentence.

Replacement workflow

1. Preserve meaning

Choose a synonym only if it keeps the core idea of "create" intact in the sentence you are editing.

2. Tune tone

Check whether the replacement sounds more formal, casual, emotional, technical, or forceful than the original word.

3. Re-read context

Read the full sentence after the swap. Keep the synonym only when the sentence becomes clearer or more precise.

Review note: Synonym lists are ranked with lexical data and reviewed for practical writing value. Use the comparison notes, sentence evidence, and source labels together; a high-ranking synonym can still be wrong when the audience, register, or grammar changes.

Final fit check

After choosing a replacement for "create", read the sentence once for meaning and once for rhythm. The best synonym should feel natural in the full sentence, not only accurate in a word list.

If the synonym makes the sentence slower, vaguer, or more dramatic than intended, keep "create" or choose a simpler alternative from the closest-match group.

How these synonyms differ

  • design - 'Design' emphasizes planning and intention, the blueprint before the execution. You design before you build.
  • establish - 'Establish' means creating something meant to endure, a foundation, an institution, a precedent. Permanence is the key.
  • generate - 'Generate' implies systematic production, generating ideas, generating revenue. It's about output rather than artistry.
  • invent - 'Invent' means bringing into existence something entirely new, it implies originality and ingenuity beyond general creation.

Related word relations

OpenGloss and ConceptNet supply richer edges like generalizations, collocations, and derivations.

6 relation types

More general

14 entries
actappointcausal verbcausechargecreative actgethaveinducemakemovestimulatetransitive verbverb

More specific

9 entries
build a modelcause a problemcraft a posterdesign a chartdesign a lessondraft a scriptgenerate interestinvent a gameproduce results

Collocations

6 entries

Inflections

3 entries

Derivations

5 entries

similar

2 entries

Translations

175 translations across 100 languages.

Powered by Wiktionary

Albanian

4 entries
  • krijoj verb (to put into existence)
  • lentoj verb (to put into existence)
  • mbaroj (gheg) verb (to put into existence)
  • sajoj verb (to put into existence)

Ancient Greek

1 entries
  • κτίζω verb (to put into existence)

Arabic

2 entries
  • خلق verb (to put into existence)
  • خَلَقَ verb (to put into existence)

Aragonese

1 entries
  • creyar verb (to put into existence)

Armenian

2 entries
  • արարել verb (to put into existence)
  • ստեղծել verb (to put into existence)

Asturian

1 entries
  • crear verb (to put into existence)

Azerbaijani

1 entries
  • yaratmaq verb (to put into existence)

Belarusian

2 entries
  • ствары́ць verb (to put into existence)
  • твары́ць verb (to put into existence)

Bengali

2 entries
  • তৈরি করা verb (to put into existence)
  • বানানো verb (to put into existence)

Bulgarian

4 entries
  • създа́вам verb (to put into existence)
  • създа́м verb (to put into existence)
  • сътворя́ verb (to put into existence)
  • сътворя́вам verb (to put into existence)

Burmese

2 entries
  • ဖန် verb (to put into existence)
  • ဖန်တီး verb (to put into existence)

Catalan

1 entries
  • crear verb (to put into existence)

Chichewa

1 entries
  • -lenga verb (to put into existence)

Chinese Mandarin

2 entries
  • 創造 /创造 verb (to put into existence)
  • 締造 /缔造 verb (to put into existence)

Church Slavic

1 entries
  • творити verb (to put into existence)

Cornish

3 entries
  • gul verb (to put into existence)
  • gwruthyl verb (to put into existence)
  • oberi verb (to put into existence)

Czech

3 entries
  • tvořit verb (to put into existence)
  • udělat verb (to put into existence)
  • vytvořit verb (to put into existence)

Danish

1 entries
  • skabe verb (to put into existence)

Dutch

3 entries
  • creëren verb (to put into existence)
  • maken verb (to put into existence)
  • scheppen verb (to put into existence)

Eastern Mari

1 entries
  • ышташ verb (to put into existence)

Egyptian

1 entries
  • p:t-H verb (to put into existence)

Esperanto

1 entries
  • krei verb (to put into existence)

Estonian

1 entries
  • looma verb (to put into existence)

Extremaduran

1 entries
  • crial verb (to put into existence)

Finnish

1 entries
  • luoda verb (to put into existence)

French

1 entries
  • créer verb (to put into existence)

Galician

1 entries
  • crear verb (to put into existence)

Georgian

1 entries
  • შექმნა verb (to put into existence)

German

2 entries
  • kreieren verb (to put into existence)
  • schaffen verb (to put into existence)

Gothic

1 entries
  • 𐌲𐌰𐍃𐌺𐌰𐍀𐌾𐌰𐌽 verb (to put into existence)

Greek

1 entries
  • δημιουργώ verb (to put into existence)

Haitian Creole

1 entries
  • kreye verb (to put into existence)

Hebrew

2 entries
  • בָּרָא verb (to put into existence)
  • יָצַר verb (to put into existence)

Higaonon

1 entries
  • agbuhaton verb (to put into existence)

Hindi

4 entries
  • बनाना verb (to put into existence)
  • रचना verb (to put into existence)
  • रचना करना verb (to put into existence)
  • सिरजना verb (to put into existence)

Hungarian

3 entries
  • alkot verb (to put into existence)
  • létrehoz verb (to put into existence)
  • teremt verb (to put into existence)

Icelandic

1 entries
  • skapa verb (to put into existence)

Ido

1 entries
  • krear verb (to put into existence)

Indonesian

1 entries
  • menciptakan verb (to put into existence)

Italian

1 entries
  • creare verb (to put into existence)

Japanese

2 entries
  • 創造する verb (to put into existence)
  • 生み出す verb (to put into existence)

Kazakh

4 entries
  • жарату verb (to put into existence)
  • жасау verb (to put into existence)
  • тудыру verb (to put into existence)
  • шығару verb (to put into existence)

Khmer

2 entries
  • បង្ក verb (to put into existence)
  • បង្កើត verb (to put into existence)

Korean

1 entries
  • 창조하다 verb (to put into existence)

Kunda

1 entries
  • -lenga verb (to put into existence)

Kyrgyz

1 entries
  • жаратуу verb (to put into existence)

Latgalian

2 entries
  • radeit verb (to put into existence)
  • taiseit verb (to put into existence)

Latin

1 entries
  • creō verb (to put into existence)

Latvian

1 entries
  • radīt verb (to put into existence)

Lenje

1 entries
  • -lenga verb (to put into existence)

Lithuanian

2 entries
  • kurti verb (to put into existence)
  • sukurti verb (to put into existence)

Lower Sorbian

1 entries
  • tworiś verb (to put into existence)

Macedonian

4 entries
  • создава verb (to put into existence)
  • создаде verb (to put into existence)
  • створи verb (to put into existence)
  • твори verb (to put into existence)

Malay

2 entries
  • cipta verb (to put into existence)
  • mencipta verb (to put into existence)

Malayalam

2 entries
  • ഉണ്ടാക്കുക verb (to put into existence)
  • സൃഷ്ടിക്കുക verb (to put into existence)

Maltese

1 entries
  • ħalaq verb (to put into existence)

Maore Comorian

1 entries
  • uumba verb (to put into existence)

Middle English

1 entries
  • formen verb (to put into existence)

Mongolian

2 entries
  • бүтээх verb (to put into existence)
  • үүсгэх verb (to put into existence)

Ngazidja Comorian

1 entries
  • huumba verb (to put into existence)

Norman

1 entries
  • créer verb (to put into existence)

Northern Kurdish

2 entries
  • afirandin verb (to put into existence)
  • xulqandin verb (to put into existence)

Norwegian

1 entries
  • skape verb (to put into existence)

Nyungwe

1 entries
  • -lenga verb (to put into existence)

Old East Slavic

1 entries
  • творити verb (to put into existence)

Old English

2 entries
  • wyrċan verb (to put into existence)
  • ġesċieppan verb (to put into existence)

Old Irish

1 entries
  • do·fuissim verb (to put into existence)

Oromo

1 entries
  • uumuu verb (to put into existence)

Persian

4 entries
  • آفریدن verb (to put into existence)
  • ایجاد کردن verb (to put into existence)
  • بوجود آوردن verb (to put into existence)
  • خلق کردن verb (to put into existence)

Piedmontese

1 entries
  • creé verb (to put into existence)

Plautdietsch

1 entries
  • schaufen verb (to put into existence)

Polish

2 entries
  • stworzyć verb (to put into existence)
  • tworzyć verb (to put into existence)

Portuguese

1 entries
  • criar verb (to put into existence)

Quechua

1 entries
  • kamay verb (to put into existence)

Romanian

1 entries
  • crea verb (to put into existence)

Russian

4 entries
  • созда́ть verb (to put into existence)
  • создава́ть verb (to put into existence)
  • сотвори́ть verb (to put into existence)
  • твори́ть verb (to put into existence)

Sanskrit

1 entries
  • कृ verb (to put into existence)

Serbo-Croatian

4 entries
  • stvárati verb (to put into existence)
  • stvòriti verb (to put into existence)
  • tvòriti verb (to put into existence)
  • ства́рати verb (to put into existence)

Silesian

1 entries
  • tworzić verb (to put into existence)

Slovak

2 entries
  • tvoriť verb (to put into existence)
  • vytvoriť verb (to put into existence)

Slovene

3 entries
  • narediti verb (to put into existence)
  • ustvariti verb (to put into existence)
  • ustvarjati verb (to put into existence)

Southern Altai

1 entries
  • јазаар verb (to put into existence)

Spanish

2 entries
  • crear verb (to put into existence)
  • generar verb (to put into existence)

Swahili

1 entries
  • kuumba verb (to put into existence)

Swedish

1 entries
  • skapa verb (to put into existence)

Tajik

2 entries
  • офаридан verb (to put into existence)
  • эҷод кардан verb (to put into existence)

Telugu

4 entries
  • కల్పించు verb (to put into existence)
  • చేయు verb (to put into existence)
  • సృజించు verb (to put into existence)
  • సృష్టించు verb (to put into existence)

Thai

2 entries
  • สร้าง verb (to put into existence)
  • สร้างสรรค์ verb (to put into existence)

Tocharian B

1 entries
  • pyutk- verb (to put into existence)

Turkish

4 entries
  • meydana getirmek verb (to put into existence)
  • oluşturmak verb (to put into existence)
  • ortaya koymak verb (to put into existence)
  • tekvin etmek verb (to put into existence)

Turkmen

1 entries
  • döretmek verb (to put into existence)

Ugaritic

1 entries
  • 𐎖𐎐𐎊 verb (to put into existence)

Ukrainian

2 entries
  • створи́ти verb (to put into existence)
  • твори́ти verb (to put into existence)

Upper Sorbian

1 entries
  • tworić verb (to put into existence)

Uyghur

1 entries
  • ياراتماق verb (to put into existence)

Uzbek

2 entries
  • ijod etmoq verb (to put into existence)
  • yaratmoq verb (to put into existence)

Vietnamese

3 entries
  • sáng tạo verb (to put into existence)
  • tạo verb (to put into existence)
  • tạo nên verb (to put into existence)

Welsh

1 entries
  • creu verb (to put into existence)

Yao

1 entries
  • kupanganya verb (to put into existence)

Yiddish

2 entries
  • באַשאַפֿן verb (to put into existence)
  • שאַפֿן verb (to put into existence)

Sample sentences

28 total sentences available.

Tatoeba + Wiktionary

Can we create something out of nothing?

Source: tatoeba (23303)

If we don't create an environment that enables instant Internet access, our company will also fall behind.

Source: tatoeba (23535)

Our cities create serious pollution problems.

Source: tatoeba (29180)

We will be able to build farms and create fields there.

Source: tatoeba (50928)

Showing 4 of 28 available sentences.

Common questions

What are the closest synonyms for "create"?

Closest matches include make, produce, cause, generate, affixes.

How is "design" different from "create"?

'Design' emphasizes planning and intention, the blueprint before the execution. You design before you build.

How should I check whether a synonym fits "create"?

Compare the replacement against real sentence context. This entry includes sample sentences so you can check tone, grammar, and meaning before swapping words.

More for "create"

Meaning

Keep exploring

Read the definitionBrowse writing guidesRead the blog