Turn

//tɜːn//

Synonyms for "turn" (1260 found)

Ranked by relevance and common usage.

Closest matches (252)

Show 211 more words
about-faceaccessacciaccaturaaccommodationaccomplished factaccomplishmentachievementact of graceact of kindnessactaactionactivateadaptadaptationaddleaddressadjustmentadventureadvert toaesthetic formaffectionaffinityafterpieceagiotageaimaim atairairingalienateall the timealteralterationalternatealternatelyalwaysambitambleameliorateameliorationan ear foran eye foranamorphismanamorphosisanchor watchangleangle offanimusapostasyapostatizeappeal toappearapplyapply toappoggiaturaaptitudeaptnessarabesquearbitragearcarcharchetypearisearousearrivearsisart formassailassembleasymmetryat every turnattackattendavertaxeback and fillbackingbackslidebackslidingbad turnbalkbatebe changedbe contingent onbe converted intobe here againbe hostile tobe renewedbearbear awaybear offbear to starboardbearingbeatbeat aboutbeat backbeat itbend backbend tobendingbenefactionbenefitbenevolencebenignitybentbetraybettermentbiasbitblessingblockblowblow hot and coldbluntboltboonborebottom outboutbowbowingbox offbranchbranch offbranching offbreakbreak backbreak downbring aboutbring outbring overbring roundbring to lightbrowbucklebuckle downbuildbumpbusiness dealbuying inby turnscadencecadenzacall offcall oncampaigncantcant roundcapacity forcapsizecarriagecashiercastcast aboutchancechange backchange by reversalchange coursechange intochange of heartchange statechange the bearingchange the headingchangeablenesscharactercharybdischasercheckcheckerchopchop and changecirclecirclingcircuitcircuitousnesscircuitrycircularitycirculatecirculationcircumlocutioncircumrotatecircumvolutecircumvolutionclabberclimactericclutchcoilcoincolorcoloraturacomecome aboutcome acrosscome againcome and gocome aroundcome intocome roundcome round againcome upcome up againcommercial transactioncompletecomplexionconatusconcernconcoctconduceconducivenessconfigurationconflexureconformation

Strong matches (378)

Show 343 more words
coursecourtesycrackcrankcreatecrinklecrisiscritical juncturecritical pointcrookcrookednesscrop upcrossroadscrucial periodcrumblecrumplecrunchcry backcurdcurdlecurlcurtaincurtain callcurtain raisercurvecutcut and runcycleday shiftdeactivatedealdealingsdecaydeclinationdeclinedecomposedecurvedeeddefectdefectiondeflectdeflectiondefydegeneratedegenerationdegenerative changedelightdeliverdemeanordenydepartdepart fromdeparturedependdepend ondepressderangedesertdeterioratedeteriorationdeterminedetorsiondetourdetractdevelopdeviancedeviancydeviatedeviationdevicedeviousnessdevotediastolediathesisdifferencediffractdiffusedig updigressdigressiondirectdirectiondirectionizedisaffectdisclosediscomposediscontinuediscontinuitydiscoverdiscursiondisedgedisenchantdisenchantmentdisgustdisillusiondisintegratedismissdisorderdispersedispleasedisposedispositiondisproportiondisservicedistortdistortiondivagatedivagationdivaricatedivaricationdivergedivergencediversificationdiversifydiversiondiversitydivertdivertimentodivertissementdivisiondizzinessdizzy rounddo a flip-flopdo an about-facedoglegdogwatchdoingdoingsdomedoubledouble a pointdownbeatdraw the teethdressdriftdriftingdrivedrive backdulleagernessebb and floweccentricityeddyeffortejectembellishmentembowemergencyemployendeavorenergizeenterpriseepilogueequipequity capitalerrantryeventuateeverywhereevictevolveexchangeexciteexcursionexcursusexigencyexodeexodusexorbitationexpeditionexpelexploitexposeexpository sceneexpressextinguishextremityfabricatefacefacial appearancefacilityfacultyfait accomplifancyfascinationfashionfastenfavorfeatfeaturefeaturesfeeling forfelicityfend offfetch aboutfigurationfigurefinalefindfingerfioriturafirefitfit outfittingfixfix onflairflectionfleeflexureflierflightflip flopflip-flopflopflounderflourishfluctuateflutterflyerforced marchformformatformationformulateframefrightfull circlefull timegarbgasgeanticlinegeniusgenius forgenregeosynclinegestgiftgift forgimmickgivegive backgive ingnarlgo aboutgo aroundgo backgo intogo offgo roundgo through phasesgo to bedgo to sleepgood deedgood officesgood turngracegrace notegrace notesgradual changegraingrand tourgraveyard shiftgravitateguisegurgegybegyrategyrationgyrehairpinhairpin turnhalf timehandhand inhand overhandiworkhanghappenhark backharmhaul aroundhave a tendencyhave recourse toheadheave roundheelhikehingehinge onhit uponhoke acthold a headinghold onhookhumphunchidiosyncrasyimbalanceimpassionimpressionimproperlyimproveimprovementimprudentlyin rotationin successionin turninappropriatelyincidentalincidental noteinclinationinclineincurvateincurveindirectionindiscreetlyindividualisminflectinflectioninform oninjuryinnate aptitudeinner forminninginningsinstinctinterludeintermezzointermissionintermitinterpretationintortintroductioninverseinversioninvertirregularityjarjauntjibejobjolt

Related words (630)

Show 571 more words
leanleaninglevellevel atliabilitylikinglineamentslinesliquidationlobster tricklong mordentlook tolookslopsidednesslurchmaelstrommakemake overmake upmakeupmaneuvermannermanufacturemarchmatrixmeandermeanderingmeasuremeetmelioratemeliorationmental setmerchandisemercymettlemienmindmind-setmiss staysmitigatemitigationmitzvahmodalitymodemodelmodificationmodifymodulatemodulationmoldmoldermordentmouldmouldermouldymushmutatemutationmutinymutual affinitymutual attractionnaturenauseatenegotiationnight shiftnumberobligationobliqueobliquityobtundoccuroffendofferofficeoperationopportunityorbitorbitingornamentoscillateoustout of orderout of turnoutingovert actoverthrowovertimeoverturnoxbowpackage dealpackage tourparadeparrypart timepartialitypasspass intopassagepatternpenchantpendpendulateperegrinationpererrationperformanceperipatetic journeyperipateticismperishphysiognomypick uppilgrimagepinchpirouettepitch inpivotpivot aboutplaceplatonic formplatonic ideapleasure tripplowplungeplypointpoint atpoint toponder overpop upportposturepowerpralltrillerpredilectionpredispositionpreferenceprejudicepresencepresentpreventprobabilityproceedingproclivityproduceproductionprofferprofit takingprogressprologuepromenadepronenesspropensityprototypeproveprypullpulsatepulsepushputput aboutput backput offput output togetherputrefyqualificationquirkradical changerambleramblingratrat racere creationre-creationreactreadinessrealignmentreappearrebuffrecidivationrecidivismreciprocallyreclamationreconversionrecurrecurveredesignredound toreducereelrefashionreferrefer toreflectreflectionreflexreformreformationrefractrefuseregressregressionrehabilitationreinstatementrejectrelapserelate torelayreliefremakingremodelrenderrenewalrenouncereoccurreorganizerepairrepeatrepelrepressrepudiaterepulseres gestaereshapereshapingresort torestitutionrestorationrestructuringresultretireretrocessionretroflexretrogradationretrogressionretroversionretundreturnreturningrevealreversalreversereversionrevertrevertingrevivalreviverevivificationrevoltrevolutionrevolverevulsionrickriderig outright-aboutring the changesrollroll aroundroll outrotrotationrouladeroundround a bendround a cornerround a pointround traderound triproundsroutinerubrubberneck tourrunrun aways-curvesacksafarisagsallysauntersayscallopscalpingscarescattersceneschlepscootscragscramscrewseesawseizuresellsensitivity tosequentiallyseriesserpentineserveservicesetset in motionset towardset uponshapesheershiftshiftingshifting courseshifting pathshockshootshotshow a tendencyshow upshtickshufflesickensightsight onsignificant formsingle mordentsinuosityskedaddlesketchskewskitslantslewslinkslipping backsluesnakesoft spotsolicitsong and dancespeculationspellspinspiralspiralingsplit schedulesplit shiftspoilspot salesprainspringstaggerstalkstampstancestandstand-up comedy actstartstart upsteerstepstimulatestintstockjobberystockjobbingstopstrainstraitstrayingstreakstretchstripestripteasestrokestrollstructurestuntstylesubmitsuccessionsuccessivelysudden changesunrise watchsurfacesurgesurprisesurrendersusceptibilityswagswaysweepswerveswervingswimswingswing roundswing shiftswing the sternswingingswirlswitchswitch offswitch onswivelsympathysystoletacktake a turntake offtake the edge offtake turnstake uptalentteeterteeter totterteeter-tottertell ontempertemperamenttendtend to gotendencytendertenortergiversatetermterminatethesisthingthing donethrillthrowthrow aboutthrow outthwarttilltimetime at battitillatetonetorsiontortuositytotal changetottertourtour de forcetour of dutytraintrain upontraipsetraittraitstramptransactiontransformtransitiontranslatetransplacetransposetrektrendtricktriptropismtrudgeturn a cornerturn a pirouetteturn aboutturn againstturn aroundturn asideturn awayturn awryturn backturn downturn forturn inturn intoturn of mindturn of workturn offturn onturn outturn overturn roundturn tailturn the cornerturn toturn turtleturn upturn uponturn upside downturnaboutturning pointtwinetwirltwist and turntypeunbalanceuncoverundergo a changeundertakingundoundulateunearthunhingeunsettleunsymmetryupbeatupheavalupsetusevacillatevariationvarietyvaryvaultveerveer aroundventureventure capitalvergevibrateviolent changevisagevoicevolte-facevortexvoyagewalkwalking tourwamblewanderingwardwarpwatchwaverwax and wanewayweakenweaknesswearwear shipweavewhackwheelwheel aboutwheel aroundwhipwhirlwhirlpoolwhirlwindwhorlwillingnesswincewindwithdrawwobbleworkwork shiftwork towardwork upworkswormworsenworseningwrenchwrestwringwrithewrongyawyieldzigzag

Related word relations

OpenGloss and ConceptNet supply richer edges like generalizations, collocations, and derivations.

12 relation types

Translations

794 translations across 110 languages.

Powered by Wiktionary

Aklanon

1 entries
  • liko' verb (move around an axis through itself)

Albanian

1 entries
  • kthej verb (change the direction or orientation of, especially by rotation)

Ancient Greek

2 entries
  • στροφή noun (change of direction or orientation)
  • στρέφω verb (change the direction or orientation of, especially by rotation)

Arabic

4 entries
  • اِنْعِطَاف noun (change of direction or orientation)
  • دَوْر noun (chance to use (something) shared in sequence with others)
  • دَوْر noun (spell of work)
  • دَوْرَة noun (movement about an axis ending up with the same orientation)

Aramaic

1 entries
  • ܦܢܐ verb (move around an axis through itself)

Armenian

4 entries
  • հերթ noun (chance to use (something) shared in sequence with others)
  • հերթ noun (one's chance to make a move in a game)
  • պտույտ noun (movement about an axis ending up with the same orientation)
  • օյին noun (one's chance to make a move in a game)

Assamese

2 entries
  • পাল noun (chance to use (something) shared in sequence with others)
  • পাল noun (one's chance to make a move in a game)

Avar

1 entries
  • сверизе verb (move around an axis through itself)

Azerbaijani

4 entries
  • növbə noun (chance to use (something) shared in sequence with others)
  • burmaq verb (change the direction or orientation of, especially by rotation)
  • döndərmək verb (change the direction or orientation of, especially by rotation)
  • döndərmək verb (position something by folding it back on itself, or using its folds)

Bashkir

4 entries
  • боролоу verb (change one's direction of travel)
  • бороу verb (change the direction or orientation of, especially by rotation)
  • бөкләү verb (position something by folding it back on itself, or using its folds)
  • бөктәү verb (position something by folding it back on itself, or using its folds)

Basque

1 entries
  • jiratu verb (move around an axis through itself)

Belarusian

4 entries
  • абаро́т noun (movement about an axis ending up with the same orientation)
  • зваро́т noun (change of direction or orientation)
  • зваро́т noun (movement about an axis ending up with the same orientation)
  • паваро́т noun (change of direction or orientation)

Bulgarian

4 entries
  • витка noun (single loop of a coil)
  • заво́й noun (change of direction or orientation)
  • оборо́т noun (movement about an axis ending up with the same orientation)
  • ред noun (spell of work)

Burmese

2 entries
  • ချိုး verb (change one's direction of travel)
  • လှည့် လှည့် verb (move around an axis through itself)

Catalan

4 entries
  • torn noun (chance to use (something) shared in sequence with others)
  • volta noun (movement about an axis ending up with the same orientation)
  • girar verb (move around an axis through itself)
  • girar verb (change the direction or orientation of, especially by rotation)

Central Kurdish

4 entries
  • خولانەوە noun (movement about an axis ending up with the same orientation)
  • سوڕاندن noun (change of direction or orientation)
  • سوڕانەوە noun (movement about an axis ending up with the same orientation)
  • نۆبە noun (chance to use (something) shared in sequence with others)

Chechen

1 entries
  • верза verb (move around an axis through itself)

Chinese

1 entries
  • verb (change one's direction of travel)

Chinese Cantonese

1 entries
  • 轉 /转 verb (change one's direction of travel)

Chinese Mandarin

4 entries
  • 旋轉 /旋转 noun (movement about an axis ending up with the same orientation)
  • noun (chance to use (something) shared in sequence with others)
  • 輪到 /轮到 noun (chance to use (something) shared in sequence with others)
  • 轉向 /转向 noun (change of direction or orientation)

Czech

4 entries
  • obrat noun (change of direction or orientation)
  • obrátka noun (movement about an axis ending up with the same orientation)
  • zatáčka noun (change of direction or orientation)
  • zákruta noun (change of direction or orientation)

Danish

4 entries
  • anfald noun (fit or period of giddiness)
  • bøjning noun (change of direction or orientation)
  • dobbeltslag noun (figure in music)
  • drejning noun (change of direction or orientation)

Dari

2 entries
  • دَوْر noun (chance to use (something) shared in sequence with others)
  • نَوْبَت noun (chance to use (something) shared in sequence with others)

Dutch

4 entries
  • beurt noun (chance to use (something) shared in sequence with others)
  • beurt noun (one's chance to make a move in a game)
  • bocht noun (change of direction or orientation)
  • draai noun (change of direction or orientation)

Esperanto

4 entries
  • vico noun (chance to use (something) shared in sequence with others)
  • vico noun (one's chance to make a move in a game)
  • aliformiĝi verb (become)
  • aliformiĝi verb (transitive: change fundamentally)

Estonian

2 entries
  • pöörduma verb (move around an axis through itself)
  • pöörlema verb (move around an axis through itself)

Finnish

4 entries
  • gruppetto noun (figure in music)
  • kaksoishele noun (figure in music)
  • kaksoislyönti noun (figure in music)
  • kierre noun (cricket: sideways movement of a ball)

French

4 entries
  • tour noun (chance to use (something) shared in sequence with others)
  • tour noun (one's chance to make a move in a game)
  • tournant noun (poker: fourth communal card in Texas hold 'em)
  • virage noun (change of direction or orientation)

Friulian

3 entries
  • gîr noun (change of direction or orientation)
  • girâ verb (move around an axis through itself)
  • girâ verb (change the direction or orientation of, especially by rotation)

Galician

4 entries
  • cambio noun (change in temperament or circumstance)
  • paseo noun (walk to and fro)
  • quenda noun (chance to use (something) shared in sequence with others)
  • quenda noun (spell of work)

Georgian

1 entries
  • ჯერი noun (chance to use (something) shared in sequence with others)

German

4 entries
  • (vollständige) Drehung noun (movement about an axis ending up with the same orientation)
  • Abbiegung noun (change of direction or orientation)
  • Doppelschlag noun (figure in music)
  • Drehung noun (change of direction or orientation)

Gothic

1 entries
  • 𐍅𐌰𐌽𐌳𐌾𐌰𐌽 verb (change the direction or orientation of, especially by rotation)

Greek

4 entries
  • περιστροφή noun (movement about an axis ending up with the same orientation)
  • σειρά noun (chance to use (something) shared in sequence with others)
  • σειρά noun (one's chance to make a move in a game)
  • στροφή noun (change of direction or orientation)

Gujarati

1 entries
  • વારો noun (chance to use (something) shared in sequence with others)

Hebrew

4 entries
  • תּוֹר noun (chance to use (something) shared in sequence with others)
  • תּוֹר noun (one's chance to make a move in a game)
  • הִסְתּוֹבֵב verb (move around an axis through itself)
  • הָפַך verb (position something by folding it back on itself, or using its folds)

Higaonon

1 entries
  • tagliko verb (move around an axis through itself)

Hindi

4 entries
  • नौबत noun (chance to use (something) shared in sequence with others)
  • पल noun (chance to use (something) shared in sequence with others)
  • पल noun (one's chance to make a move in a game)
  • बारी noun (chance to use (something) shared in sequence with others)

Hungarian

4 entries
  • beállítottság noun (character; personality; nature)
  • elfordulás noun (movement about an axis ending up with the same orientation)
  • fordulat noun (movement about an axis ending up with the same orientation)
  • fordulat noun (change in temperament or circumstance)

Icelandic

2 entries
  • beygja verb (change one's direction of travel)
  • snúa verb (change the direction or orientation of, especially by rotation)

Indonesian

4 entries
  • pas noun (chance to use (something) shared in sequence with others)
  • belok verb (change one's direction of travel)
  • berbelok verb (move around an axis through itself)
  • berpaling verb (change the direction or orientation of, especially by rotation)

Ingrian

4 entries
  • vooro noun (chance to use (something) shared in sequence with others)
  • vooro noun (one's chance to make a move in a game)
  • keertää verb (change the direction or orientation of, especially by rotation)
  • kääntää verb (change the direction or orientation of, especially by rotation)

Ingush

1 entries
  • верза verb (move around an axis through itself)

Iranian Persian

3 entries
  • دُوْر noun (chance to use (something) shared in sequence with others)
  • نُوْبَت noun (chance to use (something) shared in sequence with others)
  • گَرْدِش noun (change of direction or orientation)

Irish

4 entries
  • seal noun (chance to use (something) shared in sequence with others)
  • sníomh noun (movement about an axis ending up with the same orientation)
  • tiontú noun (change of direction or orientation)
  • cas verb (move around an axis through itself)

Italian

4 entries
  • cambiamento noun (change in temperament or circumstance)
  • china noun (change in temperament or circumstance)
  • giravolta noun (movement about an axis ending up with the same orientation)
  • giro noun (change of direction or orientation)

Japanese

4 entries
  • 回転 noun (movement about an axis ending up with the same orientation)
  • 工数 noun (time required to complete a project)
  • 巻き noun (single loop of a coil)
  • noun (chance to use (something) shared in sequence with others)

Javanese

2 entries
  • mubeng verb (move around an axis through itself)
  • muter verb (move around an axis through itself)

Kashubian

1 entries
  • òbracac verb (change the direction or orientation of, especially by rotation)

Kazakh

2 entries
  • айналу noun (change of direction or orientation)
  • кезек noun (chance to use (something) shared in sequence with others)

Khmer

3 entries
  • ត្រូវលើ noun (chance to use (something) shared in sequence with others)
  • វេន noun (chance to use (something) shared in sequence with others)
  • វេន noun (one's chance to make a move in a game)

Korean

4 entries
  • 돌기 noun (movement about an axis ending up with the same orientation)
  • 돌리기 noun (movement about an axis ending up with the same orientation)
  • 차례 noun (chance to use (something) shared in sequence with others)
  • 차례 noun (spell of work)

Kyrgyz

1 entries
  • кезек noun (chance to use (something) shared in sequence with others)

Latin

2 entries
  • torqueō verb (change the direction or orientation of, especially by rotation)
  • vertō verb (move around an axis through itself)

Lithuanian

2 entries
  • sukti verb (move around an axis through itself)
  • sukti verb (change the direction or orientation of, especially by rotation)

Lombard

1 entries
  • girà verb (move around an axis through itself)

Lower Sorbian

2 entries
  • wobrośiś verb (change the direction or orientation of, especially by rotation)
  • wobrośiś se verb (change one's direction of travel)

Macedonian

4 entries
  • свртување noun (change of direction or orientation)
  • навршувам verb (become)
  • полнам verb (become)
  • постанувам verb (become)

Malay

4 entries
  • belok verb (move around an axis through itself)
  • belok verb (change one's direction of travel)
  • belokkan verb (change the direction or orientation of, especially by rotation)
  • pusing verb (move around an axis through itself)

Malayalam

4 entries
  • തിരിയുക verb (move around an axis through itself)
  • തിരിയുക verb (change one's direction of travel)
  • തിരിയ്ക്കുക verb (change the direction or orientation of, especially by rotation)
  • തിരിയ്ക്കുക verb (shape on a lathe or similar tool)

Maltese

1 entries
  • lewa verb (move around an axis through itself)

Mansaka

1 entries
  • liko verb (move around an axis through itself)

Maore Comorian

1 entries
  • ufaliki verb (move around an axis through itself)

Mongolian

3 entries
  • ээлж noun (chance to use (something) shared in sequence with others)
  • ээлж noun (one's chance to make a move in a game)
  • эргэх verb (move around an axis through itself)

Māori

1 entries
  • matakohuki verb (move around an axis through itself)

Neapolitan

1 entries
  • votà verb (change the direction or orientation of, especially by rotation)

Norwegian

4 entries
  • bli verb (become)
  • dreie verb (change the direction or orientation of, especially by rotation)
  • dreie verb (shape on a lathe or similar tool)
  • endre verb (transitive: change fundamentally)

Norwegian Bokmål

4 entries
  • etter tur noun (chance to use (something) shared in sequence with others)
  • omdreining noun (movement about an axis ending up with the same orientation)
  • sving noun (change of direction or orientation)
  • tur noun (chance to use (something) shared in sequence with others)

Occitan

3 entries
  • girar verb (move around an axis through itself)
  • girar verb (change the direction or orientation of, especially by rotation)
  • virar verb (change the direction or orientation of, especially by rotation)

Old English

4 entries
  • hweorfan verb (change the direction or orientation of, especially by rotation)
  • hweorfan verb (become)
  • wendan verb (change the direction or orientation of, especially by rotation)
  • wendan verb (become)

Old Javanese

1 entries
  • putĕr verb (move around an axis through itself)

Ossetian

1 entries
  • зилын verb (move around an axis through itself)

Ottoman Turkish

4 entries
  • داو noun (one's chance to make a move in a game)
  • كوشه noun (change of direction or orientation)
  • نوبت noun (spell of work)
  • دونمك verb (move around an axis through itself)

Pashto

4 entries
  • اړول verb (move around an axis through itself)
  • تاوول verb (move around an axis through itself)
  • تاوول verb (change the direction or orientation of, especially by rotation)
  • تاوول verb (change one's direction of travel)

Persian

2 entries
  • چرخیدن verb (move around an axis through itself)
  • گشتن verb (move around an axis through itself)

Piedmontese

3 entries
  • vir noun (change of direction or orientation)
  • viré verb (move around an axis through itself)
  • volté verb (move around an axis through itself)

Polabian

1 entries
  • bögot verb (change the direction or orientation of, especially by rotation)

Polish

4 entries
  • kolej noun (chance to use (something) shared in sequence with others)
  • kolej noun (one's chance to make a move in a game)
  • obrót noun (change of direction or orientation)
  • obrót noun (movement about an axis ending up with the same orientation)

Portuguese

4 entries
  • espira noun (single loop of a coil)
  • girada noun (change of direction or orientation)
  • girada noun (movement about an axis ending up with the same orientation)
  • giro noun (change of direction or orientation)

Rapa Nui

2 entries
  • taviri verb (move around an axis through itself)
  • taviri verb (change one's direction of travel)

Romanian

4 entries
  • cotitură noun (change of direction or orientation)
  • viraj noun (change of direction or orientation)
  • se învârti verb (move around an axis through itself)
  • se învârti verb (change the direction or orientation of, especially by rotation)

Romansch

2 entries
  • girar verb (move around an axis through itself)
  • girar verb (change the direction or orientation of, especially by rotation)

Russian

4 entries
  • вито́к noun (single loop of a coil)
  • о́чередь noun (chance to use (something) shared in sequence with others)
  • о́чередь noun (spell of work)
  • оборо́т noun (movement about an axis ending up with the same orientation)

Scottish Gaelic

4 entries
  • car noun (change of direction or orientation)
  • car noun (movement about an axis ending up with the same orientation)
  • cuairt noun (chance to use (something) shared in sequence with others)
  • cuairt noun (one's chance to make a move in a game)

Serbo-Croatian

4 entries
  • potez noun (one's chance to make a move in a game)
  • závoj noun (change of direction or orientation)
  • за́вој noun (change of direction or orientation)
  • okrenuti se verb (move around an axis through itself)

Slovak

2 entries
  • obrátka noun (movement about an axis ending up with the same orientation)
  • zákruta noun (change of direction or orientation)

Slovene

1 entries
  • zavoj noun (change of direction or orientation)

Spanish

4 entries
  • competerle a noun (chance to use (something) shared in sequence with others)
  • girada noun (change of direction or orientation)
  • girada noun (movement about an axis ending up with the same orientation)
  • giramiento noun (change of direction or orientation)

Sundanese

1 entries
  • robah verb (become)

Swahili

1 entries
  • zamu noun (one's chance to make a move in a game)

Swedish

4 entries
  • tur noun (chance to use (something) shared in sequence with others)
  • tur noun (one's chance to make a move in a game)
  • turas om noun (chance to use (something) shared in sequence with others)
  • varv noun (single loop of a coil)

Tagalog

1 entries
  • umikot verb (move around an axis through itself)

Tajik

3 entries
  • гардиш noun (change of direction or orientation)
  • давр noun (chance to use (something) shared in sequence with others)
  • навбат noun (chance to use (something) shared in sequence with others)

Tausug

1 entries
  • giling verb (move around an axis through itself)

Telugu

4 entries
  • వంతు noun (one's chance to make a move in a game)
  • తిప్పు verb (change the direction or orientation of, especially by rotation)
  • తిరగబడు verb (rebel)
  • తిరుగు verb (move around an axis through itself)

Thai

4 entries
  • ตา noun (chance to use (something) shared in sequence with others)
  • ตา noun (one's chance to make a move in a game)
  • กลาย verb (become)
  • บูด verb (go bad)

Turkish

4 entries
  • keşik noun (chance to use (something) shared in sequence with others)
  • nöbet noun (chance to use (something) shared in sequence with others)
  • sıra noun (chance to use (something) shared in sequence with others)
  • sıra noun (one's chance to make a move in a game)

Turkmen

1 entries
  • nobat noun (chance to use (something) shared in sequence with others)

Tuvan

2 entries
  • эглир verb (change one's direction of travel)
  • ээр verb (change the direction or orientation of, especially by rotation)

Udmurt

1 entries
  • берганы verb (move around an axis through itself)

Ukrainian

4 entries
  • вито́к noun (single loop of a coil)
  • о́берт noun (movement about an axis ending up with the same orientation)
  • оборо́т noun (movement about an axis ending up with the same orientation)
  • поворо́т noun (change of direction or orientation)

Urdu

3 entries
  • باری noun (chance to use (something) shared in sequence with others)
  • موڑ noun (change of direction or orientation)
  • نَوبَت noun (chance to use (something) shared in sequence with others)

Uyghur

1 entries
  • نۆۋىت noun (chance to use (something) shared in sequence with others)

Uzbek

3 entries
  • burilish noun (change of direction or orientation)
  • gal noun (chance to use (something) shared in sequence with others)
  • navbat noun (chance to use (something) shared in sequence with others)

Vietnamese

4 entries
  • lượt noun (chance to use (something) shared in sequence with others)
  • lượt noun (one's chance to make a move in a game)
  • phiên noun (chance to use (something) shared in sequence with others)
  • quẹo verb (change one's direction of travel)

Volapük

1 entries
  • flekön verb (change one's direction of travel)

Welsh

4 entries
  • troi noun (change of direction or orientation)
  • troi noun (movement about an axis ending up with the same orientation)
  • difetha verb (go bad)
  • troi verb (go bad)

White Hmong

2 entries
  • tig verb (move around an axis through itself)
  • tig verb (change the direction or orientation of, especially by rotation)

Yiddish

3 entries
  • ריי noun (one's chance to make a move in a game)
  • דרייען verb (change the direction or orientation of, especially by rotation)
  • דרייען verb (change one's direction of travel)

Zealandic

1 entries
  • draoie verb (move around an axis through itself)

Sample sentences

79 total sentences available.

Tatoeba + Wiktionary

Mathematicians are like French people: whatever you tell them they translate it into their own language and turn it into something totally different.

Source: tatoeba (1794)

Could you turn on the light, please?

Source: tatoeba (6043)

Turn right at the crossroad.

Source: tatoeba (6047)

You have to turn in the reports on Monday.

Source: tatoeba (16174)

Showing 4 of 79 available sentences.

Data sourced from Wiktionary, WordNet, CMU, and other open linguistic databases. Updated March 2026.