The tamborim lends a very slightly uneven and highly distinctive 16th note groove to samba music.
Source: tatoeba (814505)
Uneven
/ʌnˈivən/
Synonyms for "uneven" (293 found)
Ranked by relevance and common usage.
Closest matches (59)
Verb(1 words)
apply unbalanced force
Adjective(11 words)
asymmetricasymmetricalblotchierbotchybumpierbumpiestchoppiercoarsest groundcraggiercrinkliestdisjointed farming
Noun(1 words)
calendar irregularity
Strong matches (88)
Verb(1 words)
fluctuatingfound wantinggrainygranulatedgutteringhairyhaltingharshherky-jerkyheteroclitehomespunhorripilantill-matchedill-sortedillegalimmatureimmethodicalimpairedimperfectimprecise
Show 33 more words
Adjective(25 words)
fragmented school communitygapped performanceheterogeneous mixture componentsimbalancedimbalanced forceinconsistent pacingirregularirregular cutirregular data patternirregular dayirregular edgeirregular layoutirregular movementirregular patternirregular publicationirregular shapeirregular shapesjaggyjerkierlopsided
Show 5 more words
Noun(6 words)
level mismatchlevel of shape irregularitymishmashmore unbalancedmost unbalancednonarithmetic sequence
Determiner(3 words)
more net unbalanced forcemost net unbalanced forcemost sudden motion-change
Related words (146)
nonstandardnonsymmetricalnonuniformnot perfectoddoffoff balanceoff-balanceout of proportionoverbalancedpartialpatchypimplypittedpluralisticpockypotholedraggedramblingrank
Show 77 more words
ripplyroughrough-castrough-grainedrough-hewnroughcastroughhewnruffledruggedruttedruttyscabrousscraggyscrappyshaggedshaggyshortsketchyskewskewedsnatchyspasmaticspasmicspasmodicspasticsporadicspottystaggeringtemperamentaltexturedunbalanceduncertainundeservedundevelopedundueunequableunequalunequitableunfinishedunjustunkemptunlawfulunlevelunmeetunmeritedunmethodicalunmetricalunorthodoxunperfectedunpolishedunrefinedunregularunrhythmicalunrightfulunsettledunsmoothunsoundunstableunsteadyunsymmetricalunsystematicunthoroughununiformvariablevariegatedvariformvariousvaryingveeringwanderingwantingwaveringwimpledwobblingwobblywrongwrongful
Adjective(37 words)
nonuniform distributionnubblyoddodd integerodd integersodd patternodd propertyodd three-digit numberodd-numbered itemspatchierpatchiestpebblypiecemeal lessonsraggederraggedestraggediestraggedyregional disparityrough guessrough terrains
Show 17 more words
rough woodrough-edgedrougherscratchierscratchyskewed contactsplotchiestspottiestspottystragglyunbalancedunbalanced colorunbalanced sampleunbalanced teamunequal forceunmirrored modelwartlike
Noun(7 words)
odd numberone sidedrough cutrough rock surfacesplotchingtrophic imbalanceunbalanced force causes motion
Adjective(1 words)
Related word relations
OpenGloss and ConceptNet supply richer edges like generalizations, collocations, and derivations.
More general
4 entriesMore specific
5 entriesbiased gradingbumpy surfacerugged surfaceskewed distributionunequal treatment
Collocations
5 entriesuneven distributionuneven gradesuneven grounduneven resultsuneven surface
Derivations
2 entriesAntonyms
1 entriessimilar
24 entriesShowing 16 of 24 words.
Sample sentences
14 total sentences available.
The ground was very uneven.
Source: tatoeba (2268164)
Tom rolled his ankle on some uneven ground.
Source: tatoeba (3130180)
Hikers were warned to be careful because the trail was uneven underfoot and had tree roots growing on it.
Source: tatoeba (3130214)
Showing 4 of 14 available sentences.