Fresh

/fɹɛʃ/

Synonyms for "fresh" (496 found)

Ranked by relevance and common usage.

Closest matches (100)

Strong matches (148)

Show 89 more words
Adjective(1 words)
Adjective(30 words)
dutch fris classroomfresh button mushroomsfresh growthfrischimmediatelyimpertinentimpudentinnovativeinvigoratedlatelymodern imprint logomore danish frisknatural springnew approachnew arrangementnew assignmentnew feature releasenew furniture marketnew informationnew slang term
Show 10 more words
new statesnew themenewlynonrepetitiousnonrepetitivenovel approachnovel ideanovel methodnovel solutionon demand
Adverb(3 words)
Verb(1 words)
Noun(3 words)
more novelnew vocabulary itemnuwc
Determiner(1 words)
no prior history

Related words (248)

Adjective(34 words)
one-off motif designoriginaloriginal accountoriginal dataoriginal musical pieceoverboldpromptlyraw foodsrecentrecent imprintrecentlyrefreshedrefreshfulrefreshingreinvigoratedsassysaucysmartspringlikesweet
Show 14 more words
tonicunagedundriedunfermentedunprocessedunsouredunspoileduntiredup to dateup-to-date statuswiseyoung mathematicianyoung organismyoung plant leaves
Show 189 more words
rawrecalledrecentrechercherecollectedrefreshedrefreshfulrefreshingregalingrememberedrenewedreserveretainedrevolutionaryritually pureriverrivuletromanticrosyrosy cheekedrosy-cheekedrousingruddyruderunrundlerunletrunnelrunningsassysaucysavedscathelesssempervirentshinysikesmartsmart aleckysmart asssmart-aleckysmart-asssmut-freesmutlessspankingsparesparklingspatespill streamspotlesssprysquallystainlessstiffstimulatingstoredstreamstream actionstreamletstrikingstrongsubterranean riversupernumerarysupplementalsupplementarysurplussuspendedsweettahartemperatethat bethat isto sparetonictopicaltorrenttubbedulteriorunaccustomedunaccustomed tounacquainted withunadulteratedunappliedunbeatenunbesmirchedunblemishedunblottedunbrokenunbruiseduncalled foruncalled-forunconsumedunconventionalunconversantunconversant withuncouthundamagedundefacedundefiledundeformedundemolishedunderivedundestroyedundevelopedunemployedunexercisedunexpendedunexperiencedunfadedunfamiliar withunfledgedunforgottenunhandledunharmedunhurtunimpaireduninitiateduninitiated inuninjureduniqueunmaimedunmangledunmarkedunmarredunmaturedunmuddiedunorthodoxunpollutedunpracticedunpracticed inunripeunscarredunscathedunscratchedunseasonedunshatteredunskilledunskilled inunsmirchedunsmudgedunsoiledunsophisticatedunspentunspoiledunspottedunstainedunsullieduntainteduntappeduntarnisheduntesteduntornuntoucheduntraineduntrieduntroddenunusedunused tounusualunutilizedunversedunversed inunwitheredunwornup-to-dateup-to-the-minutevernalvigorousvirginvirginalvitalvividwadiwaivedwatercoursewaterfloodwaterwaywellwell-scrubbedwell-washedwhitewhitenedwholesomewindywise asswise-assyoungyouthfulzestfulzesty
Noun(4 words)
recent social phenomenonspankingwell maintained recordsyoung artist
Verb(1 words)

Choosing the right synonym

  • Closest matches in this entry: new, novel, unused, a novice at, a stranger to.
  • Sentence evidence is available for fresh, so synonym choice can be checked against real usage rather than a flat word list.
  • Ranking signals come from wordnet, opengloss, moby, derived_reverse, and related lexical sources.

Synonym selection checklist

  • Match the part of speech before comparing meanings.
  • Check whether the synonym changes intensity, formality, or emotional tone.
  • Read the replacement inside the full sentence, not just beside "fresh".
  • Prefer the clearest word over the most unusual word when writing for speed or comprehension.

When not to replace "fresh"

Keep "fresh" when the sentence already sounds natural, when a synonym would add unintended emphasis, or when readers need the most familiar wording. A synonym should clarify or sharpen the message, not simply make the sentence look more varied.

If two options seem close, choose the one that best matches the audience and purpose of the sentence.

Replacement workflow

1. Preserve meaning

Choose a synonym only if it keeps the core idea of "fresh" intact in the sentence you are editing.

2. Tune tone

Check whether the replacement sounds more formal, casual, emotional, technical, or forceful than the original word.

3. Re-read context

Read the full sentence after the swap. Keep the synonym only when the sentence becomes clearer or more precise.

Review note: Synonym lists are ranked with lexical data and reviewed for practical writing value. Use the comparison notes, sentence evidence, and source labels together; a high-ranking synonym can still be wrong when the audience, register, or grammar changes.

Final fit check

After choosing a replacement for "fresh", read the sentence once for meaning and once for rhythm. The best synonym should feel natural in the full sentence, not only accurate in a word list.

If the synonym makes the sentence slower, vaguer, or more dramatic than intended, keep "fresh" or choose a simpler alternative from the closest-match group.

Related word relations

OpenGloss and ConceptNet supply richer edges like generalizations, collocations, and derivations.

7 relation types

More general

8 entries
approachconceptconditionmanner adverbpropertystatestate adverbtime adverb

More specific

20 entries
fresh approachfresh batchfresh datafresh designfresh materialfresh methodologyfresh reagentfresh releasefresh samplefresh solutionfresh theoryimmediate productionlatest resultsnew datanew stockon demand preparation

Showing 16 of 20 words.

Collocations

9 entries
fresh approachfresh batchfresh calibrationfresh datafresh firmwarefresh reagentsfresh releasefresh samplefresh solution

Inflections

2 entries

Derivations

3 entries

Antonyms

3 entries

similar

23 entries

Showing 16 of 23 words.

Sample sentences

67 total sentences available.

Tatoeba + Wiktionary

In this harsh, petty world where money does the talking, his way of life is like a breath of fresh air.

Source: tatoeba (18627)

It is still fresh in my memory.

Source: tatoeba (20212)

Our new English teacher is fresh from college.

Source: tatoeba (23384)

Flowers and trees need clean air and fresh water.

Source: tatoeba (23740)

Showing 4 of 67 available sentences.

Common questions

What are the closest synonyms for "fresh"?

Closest matches include new, novel, unused, a novice at, a stranger to.

How should I check whether a synonym fits "fresh"?

Compare the replacement against real sentence context. This entry includes sample sentences so you can check tone, grammar, and meaning before swapping words.

More for "fresh"