Rally

//ˈɹæli//

Synonyms for "rally" (521 found)

Ranked by relevance and common usage.

Closest matches (105)

Strong matches (156)

Related words (260)

Show 223 more words
joshjoustjuxtaposekickkidkindleleaguelend a handlend one aidleveelevylineline uplinkloutlowlumplump togethermake a comebackmake upmarchmarket pricemarket valuemarshalmassmatchmatchingmeetmeetingmergemillmobilizationmobilizemockneedlenettlenominal valuenonviolent protestobjectobjectionofferoffering priceolympiadolympic gamesolympicsopening priceorganizepairpanelparpar valueparcel outparitypartnerpartyperk uppickpick uppicketpicketingpiqueplacepleadplenumpolitickingpoohpooh poohpooh-poohpresentpress objectionspriceproduceproffer aidpromprotectprotestprotest demonstrationprotestationprovokepullpull roundpull throughput downput onput priceput togetherput up toqualmquizquorumquotationquoted priceraceragrail atraiseraise a howlrake uprally aroundrally roundrallying cryrangerank outrazzrebel yellreceptionreclaimrecollectrecoverrecoveryrecruitrecruitmentrecuperaterecuperationredeemrefreshregattaregimentrelieveremedyremonstranceremonstrateremonstrationrencontrerender assistancerendezvousrenewrenewalrescuerestoreresuscitatereturnrevilerevivalreviveribrideridiculeroastround uprousesavescoffscoutscrape togetherscrupleseanceseethesessionset onset outset upsettling priceshindigsic onsit insit-insittingslamslap atsleep it offslogansnap out of itsneersneer atsoireespacespursquawkstate a grievancestated valuesteelstirstir the embersstir upstreamstrikestumpingsuccorsummonsurgesurviveswarmswingswingsswipesymposiumsynodtake in towtake uptantalizetauntteach inteach-intestthe olympicsthrillthrongtickletilttournamenttourneytrack meettrialtrooptrumpet callturn the cornerturnouttwitunitewakewakenwar crywar whoopwatchwordweather the stormwhetwhip inwhip upwhistle-stoppingwork upworryyell bloody murder

Related word relations

OpenGloss and ConceptNet supply richer edges like generalizations, collocations, and derivations.

9 relation types

Translations

157 translations across 53 languages.

Powered by Wiktionary

Albanian

1 entries
  • miting noun (public gathering for a cause)

Arabic

3 entries
  • تَجَمُّع noun (public gathering for a cause)
  • تَظَاهُر noun (public gathering for a cause)
  • مُظَاهَرَة noun (public gathering for a cause)

Armenian

3 entries
  • հանրահավաք noun (public gathering for a cause)
  • միտինգ noun (public gathering for a cause)
  • ցույց noun (public gathering for a cause)

Azerbaijani

1 entries
  • mitinq noun (public gathering for a cause)

Belarusian

1 entries
  • мі́тынг noun (public gathering for a cause)

Bulgarian

4 entries
  • възстановя́ване noun (a recovery after a decline in prices)
  • ми́тинг noun (public gathering for a cause)
  • оживле́ние noun (a recovery after a decline in prices)
  • размя́на noun (squash, table tennis, tennis, badminton: sequence of strokes)

Catalan

4 entries
  • comicis noun (public gathering for a cause)
  • intercanvi de cops noun (squash, table tennis, tennis, badminton: sequence of strokes)
  • míting noun (public gathering for a cause)
  • piloteig noun (squash, table tennis, tennis, badminton: sequence of strokes)

Chinese Mandarin

3 entries
  • 大會 /大会 noun (public gathering for a cause)
  • 拉力賽 /拉力赛 noun (motor racing: event)
  • 集會 /集会 noun (public gathering for a cause)

Czech

4 entries
  • rally noun (motor racing: event)
  • rallye noun (motor racing: event)
  • shromáždění noun (public gathering for a cause)
  • výměna noun (squash, table tennis, tennis, badminton: sequence of strokes)

Danish

1 entries
  • duel noun (squash, table tennis, tennis, badminton: sequence of strokes)

Dutch

4 entries
  • betoging noun (public gathering for a cause)
  • demonstratie noun (public gathering for a cause)
  • meeting noun (public gathering for a cause)
  • samenkomst noun (public gathering for a cause)

Estonian

3 entries
  • koosolek noun (public gathering for a cause)
  • koostulek noun (public gathering for a cause)
  • miiting noun (public gathering for a cause)

Finnish

4 entries
  • kokoontuminen noun (public gathering for a cause)
  • mielenosoitus noun (public gathering for a cause)
  • puhetilaisuus noun (public gathering for a cause)
  • ralli noun (motor racing: event)

French

4 entries
  • manifestation noun (public gathering for a cause)
  • meeting noun (public gathering for a cause)
  • rally noun (motor racing: event)
  • rallye noun (motor racing: event)

Galician

1 entries
  • mitin noun (public gathering for a cause)

Georgian

2 entries
  • მასობრივი მიტინგი noun (public gathering for a cause)
  • მიტინგი noun (public gathering for a cause)

German

3 entries
  • Ballwechsel noun (squash, table tennis, tennis, badminton: sequence of strokes)
  • Kundgebung noun (public gathering for a cause)
  • Rallye noun (motor racing: event)

Greek

4 entries
  • διαδήλωση noun (public gathering for a cause)
  • πολιτική συγκέντρωση noun (public gathering for a cause)
  • ράλι noun (motor racing: event)
  • ράλλυ noun (motor racing: event)

Hebrew

1 entries
  • עֲצֶרֶת noun (public gathering for a cause)

Hungarian

3 entries
  • gyűlés noun (public gathering for a cause)
  • rali noun (motor racing: event)
  • tüntetés noun (public gathering for a cause)

Iranian Persian

2 entries
  • تَظاهَرات noun (public gathering for a cause)
  • راهْپِیْمایی noun (public gathering for a cause)

Italian

2 entries
  • manifestazione noun (public gathering for a cause)
  • raduno noun (public gathering for a cause)

Japanese

4 entries
  • ラリー noun (squash, table tennis, tennis, badminton: sequence of strokes)
  • ラリー noun (motor racing: event)
  • 大会 noun (public gathering for a cause)
  • 集会 noun (public gathering for a cause)

Kazakh

1 entries
  • митинг noun (public gathering for a cause)

Khmer

2 entries
  • ក្បួនហែ noun (public gathering for a cause)
  • សមជ្ជ noun (public gathering for a cause)

Korean

4 entries
  • 대회 noun (public gathering for a cause)
  • 랠리 noun (squash, table tennis, tennis, badminton: sequence of strokes)
  • 랠리 noun (motor racing: event)
  • 집회 noun (public gathering for a cause)

Kyrgyz

1 entries
  • митинг noun (public gathering for a cause)

Latin

3 entries
  • concursus populi noun (public gathering for a cause)
  • contiō noun (public gathering for a cause)
  • protestatio popularis noun (public gathering for a cause)

Latvian

2 entries
  • mītings noun (public gathering for a cause)
  • sapulce noun (public gathering for a cause)

Lithuanian

2 entries
  • mitingas noun (public gathering for a cause)
  • susirinkimas noun (public gathering for a cause)

Macedonian

1 entries
  • митинг noun (public gathering for a cause)

Mongolian

1 entries
  • жагсаал noun (public gathering for a cause)

Māori

1 entries
  • taupatupatu noun (squash, table tennis, tennis, badminton: sequence of strokes)

Norwegian

4 entries
  • ballveksling noun (squash, table tennis, tennis, badminton: sequence of strokes)
  • fylke seg verb (to come into orderly arrangement)
  • komme seg verb (to collect one's vital powers or forces)
  • komme til krefter verb (to collect one's vital powers or forces)

Norwegian Bokmål

1 entries
  • rally noun (motor racing: event)

Norwegian Nynorsk

1 entries
  • rally noun (motor racing: event)

Polish

3 entries
  • manifestacja noun (public gathering for a cause)
  • rajd noun (motor racing: event)
  • wiec noun (public gathering for a cause)

Portuguese

4 entries
  • comício noun (public gathering for a cause)
  • rali noun (motor racing: event)
  • reagrupar verb (to come into orderly arrangement)
  • reorganizar verb (to collect, and reduce to order, as troops dispersed or thrown into confusion)

Romanian

2 entries
  • adunare noun (public gathering for a cause)
  • miting noun (public gathering for a cause)

Russian

4 entries
  • автора́лли noun (motor racing: event)
  • ми́тинг noun (public gathering for a cause)
  • ра́лли noun (public gathering for a cause)
  • ра́лли noun (motor racing: event)

Serbo-Croatian

2 entries
  • mìting noun (public gathering for a cause)
  • мѝтинг noun (public gathering for a cause)

Slovak

1 entries
  • zhromaždenie noun (public gathering for a cause)

Spanish

4 entries
  • mitin noun (public gathering for a cause)
  • mitín noun (public gathering for a cause)
  • rally noun (motor racing: event)
  • allegar verb (to collect, and reduce to order, as troops dispersed or thrown into confusion)

Swedish

4 entries
  • demonstration noun (public gathering for a cause)
  • massmöte noun (public gathering for a cause)
  • samling noun (public gathering for a cause)
  • valmöte noun (public gathering for a cause)

Tagalog

2 entries
  • miting noun (public gathering for a cause)
  • pulungan noun (public gathering for a cause)

Tajik

3 entries
  • митинг noun (public gathering for a cause)
  • роҳпаймоӣ noun (public gathering for a cause)
  • тазоҳурот noun (public gathering for a cause)

Thai

2 entries
  • การชุมนุม noun (public gathering for a cause)
  • การเดินขบวน noun (public gathering for a cause)

Turkish

2 entries
  • gösteri noun (public gathering for a cause)
  • miting noun (public gathering for a cause)

Turkmen

1 entries
  • miting noun (public gathering for a cause)

Ukrainian

1 entries
  • мі́тинг noun (public gathering for a cause)

Urdu

1 entries
  • جَلْسَہ noun (public gathering for a cause)

Uzbek

1 entries
  • miting noun (public gathering for a cause)

Vietnamese

2 entries
  • cuộc vận động noun (public gathering for a cause)
  • mít tinh noun (public gathering for a cause)

Sample sentences

24 total sentences available.

Tatoeba + Wiktionary

When is the pep rally?

Source: tatoeba (273978)

I'm going to a monster truck rally.

Source: tatoeba (1629777)

Do you really want to go to the pep rally?

Source: tatoeba (2028340)

He's a rally driver.

Source: tatoeba (3877377)

Showing 4 of 24 available sentences.

Data sourced from Wiktionary, WordNet, CMU, and other open linguistic databases. Updated March 2026.