Let's split it.
Source: tatoeba (21242)
Split
//splɪt//
Synonyms for "split" (689 found)
Ranked by relevance and common usage.
Closest matches (138)
Verb(15 words)
burstcleavecutdividerentripschismseparatetake offablateabruptabsquatulateabysmabyssaggravatedagree to disagreealienatealienationallotamputate
Show 98 more words
apertureapportionarroyoassessable stockatomizeauthorized capital stockaxbe in stitchesbeat itbeguilebetraybifurcatebifurcatedbirthmarkbisectbisectedblackheadblebblemishblemishedblisterblowblue chipblue chip stockborrowed stockbox canyonbranchbranchedbranchingbreachbreach of friendshipbreakbreak inbreak intobreak openbreak throughbreak to piecesbreak upbreak withbreakagebroachbroachingbrokenbullaburnedburst inburst into laughterburst outburst out laughingburst with laughterbustbust a gutbust inbustedbutcherby twocachinnatecacklecanyoncapital stockcarvecarve upcast offcast outcave incavitychannelchapchasmcheckcheckedchimneychinkchinkychipchippedchopchortlechucklecicatrixcicatrizecicatrizedclearingcleavagecleftcleuchcloughclovencolcome apartcome unstuckcomedocommon stockconsumeconvertible preferred stockcorporate stockcorrodecoulee
Noun(1 words)
Strong matches (207)
couloircrackcrack upcrackedcrannycratercrazecrazedcrevassecrevicecrosscrowcrumblecrumble into dustcumulative preferred stockcut adriftcut apartcut awaycut in twocut off
Show 162 more words
cut opencut outcut upcwmcyclical stockdamageddeal outdecampdecaydecomposedefacedefaceddefacementdefectdefectivedefensive stockdeferred stockdefiledeformdeformationdeformeddeformitydehiscentdeletedelldemolishdepartdetachdeteriorateddichotomizedichotomousdichotomydikedimidiatedisaffectiondisarticulatedisassembledisclosuredisconnectdiscorddisengagedisfavordisfigurationdisfiguredisfigureddisfigurementdisintegratedisjoindisjointdismantledisorganizedispartdisruptiondissectdisseverdissociatedissolvedistortdistorteddistortiondistributedistrictdisuniondisunitedisunityditchdivaricatedivergedivergencedivide into sharesdivide updivide withdivideddividednessdivisiondivorcedivorceddivvydivvy updog itdole outdongadouble-crossdrawduck and runduck outeighth stockejectembitteredequitiesequityequity securityerodeestrangeestrangementexacerbatedexcavationexciseexfoliateexpelfactionfall outfall to piecesfalling outfalling-outfanciesfaultfaultyfenestrafissionfissurefissuredfissuryfistulaflawflawedfleeflightfloating stockflumefly openfontanelforamenforce openforkforkedforkingfracturefracturedfragmentfragmentedfrecklefurrowgapgapegapinggappygashgatgigglegive awaygive wayglamour issuegogo into convulsionsgo separate waysgorgegroovegrowth stockguaranteed stockguffawgulchgulfgullyha haha-hahackhalvehalvedharmedhave a falling-outhee-haw
Verb(16 words)
Adjective(3 words)
Adjective(3 words)
Intj(3 words)
Related words (344)
hee-heeheelhemangiomahewhiatushickeyhigh-flierho hoho-hoholehollowhorselaughhot issuehurthypothecated stockimpairedimperfectin bitsin halfin pieces
Show 290 more words
in shardsin shredsinactive stockinciseincisionincome stockindustrialsinjuredinletinterruptionintervalirritatedisolateissued capital stockjigsawjointkeloidkeloidalkinkkinkedklooflaceratelaceratedlacunalamlancelaughlaugh it uplaugh outrightlay openlaying openleakleavelentigoletter stockloaned stocklong stockmake mincemeat ofmake offmangledmarmarredmashmiliummoatmoldermolemutilatednearly die laughingneedle scarnevusnonassessable stocknonvoting stocknotchnullahopeopenopen ruptureopen upopeningopening upordinary sharesorificeoutletpale blue chipparcelparcel outparepartpart companyparticipating preferred stockpartingpartitionpasspassagepassagewaypenny stockpick to piecespimplepimpledpimplypitpockpockmarkporeport-wine markport-wine stainportionpowderpreference stockpreferred stockprize openprotective stockprunepull apartpull awaypull backpull in piecespull outpull to piecespulverizepustulequarter stockquarteredraggedrailsramifiedramifyravinerecall of ambassadorsreduce to rubblerendreverse splitriftrimerimoserimuloseriverivenroarroar with laughterrollrupturerupturedsawscabscabbedscabbyscaldedscalescarscarifiedscarifyscarredscissorscissurescorchedscramscratchseamseasoned stocksebaceous cystsectionsegmentsegregatesellsell outseparatedseparationsequesterset apartset asideseverseveredshake like jellyshake with laughtershareshare ledgershare outshare withsharesshattershatteredshort stockshoutshreddedshriekshut offskedaddleskillskin outskipskip outslashslashedsliceslice the pieslice upslitslotsmashsmashedsnapsnickersniggersnipsnortspacespecial situation stockspecialty stockspeculative stocksplintersplinteredsplit in twosplit opensplit upsplit with laughterspreadspread outspringspring a leakspring opensprungstand aloofstand apartstand asidestandard stockstartsteelsteelsstep asidestockstock ledgerstock liststock splitstocksstomastove instrawberry markstysubdividesubtractsulcussunderswing opentaketake a powdertake aparttaptatteredteartear aparttear opentear to piecestear to shredstear to tatterstee heetee-heeten-share unit stockthe worse forthrow offthrow openthrow outthrowing opentittertorntotaltracktransecttreasury stocktrenchtwisttwistedunbuilduncorkinguncoupleundounissued capital stockunmakeunstoppingunyokeutilitiesvalleyvamooseverrucavesiclevoidvoting stockwadiwalewarpwarpedwartwaste awayweakenedwealwear awayweltwenwhiteheadwhittlewithdrawworseworse offworsenedwrack upwreckyawnyuk-yukzone
Verb(25 words)
leavemake tracksmove onnamouspiss offpull up stakesput outquitremoveriverun alongrun outseparateset forthset offset outskillsling one's hookstartstart out
Show 5 more words
Intj(1 words)
Adjective(1 words)
Related word relations
OpenGloss and ConceptNet supply richer edges like generalizations, collocations, and derivations.
More general
36 entriesShowing 16 of 36 words.
More specific
9 entriesAntonyms
3 entriesSynonyms
9 entriesRelated terms
4 entriesat location
1 entriesderived
129 entriesShowing 16 of 129 words.
has context
19 entriesShowing 16 of 19 words.
is a
9 entriespart of
1 entriesrelated to
70 entriesShowing 16 of 70 words.
similar
4 entriesTranslations
432 translations across 87 languages.
Acehnese
1 entries- plah verb (divide along a more or less straight line)
Albanian
4 entries- ndar adj (divided)
- nda verb (divide along a more or less straight line)
- nda verb (leave)
- ndaj verb ((intransitive) separate)
Ancient Greek
4 entries- σχιστός adj (divided)
- Ἀσπάλαθος name (port city in Croatia)
- σχίσμα noun (crack, longitudinal fissure)
- μερίζω verb (share out)
Arabic
4 entries- أَسْبَاَلطُو name (port city in Croatia)
- سِبْلِيت name (port city in Croatia)
- انفصل verb ((intransitive) separate)
- فَصَل verb (divide along a more or less straight line)
Aromanian
2 entries- disic verb (divide along a more or less straight line)
- spãntic verb (divide along a more or less straight line)
Assamese
1 entries- ফাল verb (divide along a more or less straight line)
Azerbaijani
2 entries- yarıq noun (crack, longitudinal fissure)
- bölmək verb (share out)
Balinese
2 entries- belah verb (divide along a more or less straight line)
- tebih verb (divide along a more or less straight line)
Bashkir
1 entries- ярыҡ noun (crack, longitudinal fissure)
Bulgarian
4 entries- разцепен adj (divided)
- Сплит name (port city in Croatia)
- междинно време noun (athletics: intermediate time)
- процеп noun (crack, longitudinal fissure)
Burmese
1 entries- ခွဲ verb (divide along a more or less straight line)
Catalan
4 entries- banyes noun (bowling: pattern with missing intermediate pins)
- espagat noun (manoeuvre, acrobatic feat ("splits"))
- dividir verb (divide along a more or less straight line)
- dividir verb (share out)
Chinese Mandarin
4 entries- 斯普利特 name (port city in Croatia)
- 分裂 verb (divide along a more or less straight line)
- 裂 verb (divide along a more or less straight line)
- 裂開 /裂开 verb (divide along a more or less straight line)
Corsican
2 entries- Sbalatu name (port city in Croatia)
- Spalatu name (port city in Croatia)
Czech
4 entries- rozdělený adj (divided)
- rozpolcený adj (divided)
- rozštěpený adj (divided)
- provaz noun (manoeuvre, acrobatic feat ("splits"))
Danish
1 entries- Split name (port city in Croatia)
Dutch
4 entries- verdeeld adj (divided)
- afsplitsing noun (breach, division)
- opsplitsen verb (divide along a more or less straight line)
- splitsen verb (divide along a more or less straight line)
Egyptian
1 entries- Q3:O34-N37:Z9-Y1 verb (share out)
Esperanto
2 entries- dividi verb (divide along a more or less straight line)
- fendi verb (divide along a more or less straight line)
Evenki
1 entries- дэлки verb (divide along a more or less straight line)
Finnish
4 entries- Split name (port city in Croatia)
- haljas noun (section of skin)
- halkeama noun (crack, longitudinal fissure)
- jako noun (gambling: division of a stake)
French
4 entries- divisé adj (divided)
- Split name (port city in Croatia)
- division noun (breach, division)
- fissure noun (crack, longitudinal fissure)
Galician
4 entries- dividida adj (divided)
- divididas adj (divided)
- dividido adj (divided)
- divididos adj (divided)
Georgian
2 entries- გაპობა verb (divide along a more or less straight line)
- გახლეჩა verb (divide along a more or less straight line)
German
4 entries- gespalten adj (divided)
- Split name (port city in Croatia)
- Riss noun (crack, longitudinal fissure)
- Spagat noun (manoeuvre, acrobatic feat ("splits"))
Greek
4 entries- Σπλιτ name (port city in Croatia)
- ρήγμα noun (tear resulting from tensile stresses)
- σπαγκάτο noun (manoeuvre, acrobatic feat ("splits"))
- σπάω verb (leave)
Hawaiian
1 entries- kōhi verb (divide along a more or less straight line)
Hebrew
4 entries- ספליט name (port city in Croatia)
- שפאגט noun (manoeuvre, acrobatic feat ("splits"))
- התחלק verb (share out)
- חילק verb (divide along a more or less straight line)
Hindi
4 entries- स्प्लित name (port city in Croatia)
- दरार noun (crack, longitudinal fissure)
- दरार noun (breach, division)
- चीरना verb (divide along a more or less straight line)
Hungarian
4 entries- megosztott adj (divided)
- osztott adj (divided)
- franciaspárga noun (manoeuvre, acrobatic feat ("splits"))
- harántspárga noun (manoeuvre, acrobatic feat ("splits"))
Icelandic
4 entries- skiptur adj (divided)
- splitt noun (manoeuvre, acrobatic feat ("splits"))
- klofna verb (divide along a more or less straight line)
- skiljast að verb ((intransitive) separate)
Ido
1 entries- fendar verb (divide along a more or less straight line)
Indonesian
1 entries- belah verb (divide along a more or less straight line)
Ingrian
1 entries- halettaa verb (divide along a more or less straight line)
Irish
4 entries- scoilte adj (divided)
- scoilt noun (crack, longitudinal fissure)
- scáineadh noun (crack, longitudinal fissure)
- deighil verb (divide along a more or less straight line)
Italian
4 entries- Spalato name (port city in Croatia)
- spaccata noun (manoeuvre, acrobatic feat ("splits"))
- dividere verb (divide along a more or less straight line)
- dividere verb (share out)
Japanese
4 entries- スプリット name (port city in Croatia)
- スプリト name (port city in Croatia)
- スプリット noun (bowling: pattern with missing intermediate pins)
- ハーフボトル noun (bottle of 0.375 liters)
Javanese
1 entries- nyigar verb (divide along a more or less straight line)
Judeo-Italian
1 entries- רוּנְפַאמֵינְטוֹ noun (breach, division)
Kazakh
1 entries- жару verb (divide along a more or less straight line)
Khiamniungan Naga
1 entries- ēmthàh verb (divide along a more or less straight line)
Korean
4 entries- 스플리트 name (port city in Croatia)
- 스플릿 noun (bowling: pattern with missing intermediate pins)
- 나누다 verb (divide along a more or less straight line)
- 나누다 verb (share out)
Kyrgyz
1 entries- жаруу verb (divide along a more or less straight line)
Latgalian
1 entries- škeļt verb (divide along a more or less straight line)
Latin
4 entries- fissus adj (divided)
- Aspalatum name (port city in Croatia)
- Spalatrum name (port city in Croatia)
- Spalatum name (port city in Croatia)
Latvian
1 entries- šķelt verb (divide along a more or less straight line)
Lower Sorbian
1 entries- kłojś verb (divide along a more or less straight line)
Malay
1 entries- belah verb (divide along a more or less straight line)
Māori
4 entries- mātītore adj (divided)
- mahue verb ((intransitive) separate)
- matakahi verb (divide along a more or less straight line)
- mātītore verb (divide along a more or less straight line)
Nanai
1 entries- дэлки verb (divide along a more or less straight line)
Ngazidja Comorian
1 entries- upasuha verb (divide along a more or less straight line)
Northern Altai
1 entries- чарарга verb (divide along a more or less straight line)
Odia
1 entries- ଫାଟିବା verb (divide along a more or less straight line)
Old English
1 entries- clēofan verb (divide along a more or less straight line)
Old Irish
3 entries- etarscarthae adj (divided)
- con·fodlai verb (share out)
- dluigid verb (divide along a more or less straight line)
Ottoman Turkish
2 entries- اسپالتو name (port city in Croatia)
- یارمق verb (divide along a more or less straight line)
Persian
4 entries- بشکلیدن verb (divide along a more or less straight line)
- به چاک زدن verb (leave)
- جدایی افتادن verb ((intransitive) separate)
- جدایی انداختن verb (share out)
Polish
4 entries- Split name (port city in Croatia)
- odprysk noun (split-off piece)
- odłamek noun (split-off piece)
- rozłam noun (breach, division)
Portuguese
4 entries- Split name (port city in Croatia)
- espacate noun (manoeuvre, acrobatic feat ("splits"))
- espargata noun (manoeuvre, acrobatic feat ("splits"))
- fenda noun (crack, longitudinal fissure)
Quechua
3 entries- ch'iqtay verb (divide along a more or less straight line)
- laray verb (divide along a more or less straight line)
- puchqay verb (divide along a more or less straight line)
Rapa Nui
1 entries- ngahaa verb (divide along a more or less straight line)
Rarotongan
1 entries- to‘i verb (divide along a more or less straight line)
Romanian
4 entries- spagat noun (manoeuvre, acrobatic feat ("splits"))
- șpagat noun (manoeuvre, acrobatic feat ("splits"))
- despica verb (divide along a more or less straight line)
- diviza verb (divide along a more or less straight line)
Romansch
4 entries- divider verb (divide along a more or less straight line)
- divider verb (share out)
- fender verb (divide along a more or less straight line)
- reparter verb (share out)
Russian
4 entries- Сплит name (port city in Croatia)
- разры́в noun (breach, division)
- раско́л noun (breach, division)
- расще́лина noun (crack, longitudinal fissure)
Sanskrit
1 entries- भिनत्ति verb (divide along a more or less straight line)
Serbo-Croatian
2 entries- Splȉt name (port city in Croatia)
- Спли̏т name (port city in Croatia)
Slovene
1 entries- Split name (port city in Croatia)
Southern Altai
1 entries- јарар verb (divide along a more or less straight line)
Spanish
4 entries- dividido adj (divided)
- escindido adj (short exact sequence)
- hendido adj (divided)
- partido adj (divided)
Sundanese
1 entries- beulah verb (divide along a more or less straight line)
Swedish
4 entries- fragment noun (split-off piece)
- hål noun (bowling: pattern with missing intermediate pins)
- spricka noun (crack, longitudinal fissure)
- dela verb (divide along a more or less straight line)
Tahitian
1 entries- tohi verb (divide along a more or less straight line)
Telugu
2 entries- చీలుచు verb (divide along a more or less straight line)
- చీల్చు verb (divide along a more or less straight line)
Tetum
2 entries- fera verb (divide along a more or less straight line)
- fota verb (divide along a more or less straight line)
Tocharian B
1 entries- kaut verb (divide along a more or less straight line)
Tooro
3 entries- asa verb (divide along a more or less straight line)
- leremuka verb ((intransitive) separate)
- leremura verb (divide along a more or less straight line)
Turkish
4 entries- bölünme noun (breach, division)
- yarık noun (crack, longitudinal fissure)
- çatlak noun (crack, longitudinal fissure)
- şpagat noun (manoeuvre, acrobatic feat ("splits"))
Ukrainian
2 entries- Поперечка noun (manoeuvre, acrobatic feat ("splits"))
- щі́лина noun (crack, longitudinal fissure)
Uzbek
2 entries- tilmoq verb (divide along a more or less straight line)
- yormoq verb (divide along a more or less straight line)
Venetan
1 entries- Spàlato name (port city in Croatia)
Vietnamese
3 entries- chẻ verb (divide along a more or less straight line)
- tách verb ((intransitive) separate)
- xẻ verb (divide along a more or less straight line)
Walloon
4 entries- creveure noun (crack, longitudinal fissure)
- crevåde noun (crack, longitudinal fissure)
- findaxhe noun (crack, longitudinal fissure)
- finte noun (crack, longitudinal fissure)
Welsh
1 entries- hollti verb (divide along a more or less straight line)
Yakut
1 entries- хайыт verb (divide along a more or less straight line)
Yiddish
1 entries- שפּאַלטן verb (divide along a more or less straight line)
Zealandic
1 entries- spliete verb (divide along a more or less straight line)
Sample sentences
30 total sentences available.
The committee was split over the project.
Source: tatoeba (28258)
The money will probably be split evenly between those two.
Source: tatoeba (50589)
Computers are capable of doing very complicated work in a split second.
Source: tatoeba (54546)
Showing 4 of 30 available sentences.
Keep exploring
Data sourced from Wiktionary, WordNet, CMU, and other open linguistic databases. Updated March 2026.